PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g08220.1.p
Common NameBRADI_4g08220, LOC100823903
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 337aa    MW: 35131.7 Da    PI: 9.8704
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g08220.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.63e-182469147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W++eEde l ++v ++G ++W++I++ ++ gR++k+c++rw + 
  Bradi4g08220.1.p 24 KGPWSPEEDEALQRLVGRHGARNWSLISKSIP-GRSGKSCRLRWCNQ 69
                      79******************************.***********985 PP

2Myb_DNA-binding54.13.6e-1778120347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T++Ede +++a++++G++ W+tIar ++ gRt++ +k++w++ 
  Bradi4g08220.1.p  78 PFTADEDEAILRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 120
                       89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.1861974IPR017930Myb domain
SuperFamilySSF466892.96E-3121117IPR009057Homeodomain-like
SMARTSM007174.0E-162372IPR001005SANT/Myb domain
PfamPF002497.8E-182469IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-252577IPR009057Homeodomain-like
CDDcd001671.86E-152668No hitNo description
SMARTSM007177.7E-1575123IPR001005SANT/Myb domain
PROSITE profilePS5129420.3176125IPR017930Myb domain
CDDcd001674.21E-1278121No hitNo description
PfamPF002492.2E-1478120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2378124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MAAAAAACRA GGGGVGSKDA DRIKGPWSPE EDEALQRLVG RHGARNWSLI SKSIPGRSGK  60
SCRLRWCNQL SPQVEHRPFT ADEDEAILRA HARFGNKWAT IARLLNGRTD NAIKNHWNST  120
LKRKYSSMPA GGAGGAGGAD DGGDDVAARP LKRTSSDGHP GLCFSPGSPS GSDLSDSSHH  180
SLPSVMPSSS THVYRPVARA GGVVVLPTAA ATPPQPQPAS PPPAPAPATS LSLSLSLPGL  240
DPSQSHSQAP AAVLPAAPGA QAQAQVQMAF QLQPPPPAMN LAAPRPPAPF TGEFLSMMQE  300
MIRIEVRNYM SGFDTRSPAD AVHAANRMMM SMTKIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-39211244107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00274DAPTransfer from AT2G23290Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0857141e-118BT085714.2 Zea mays full-length cDNA clone ZM_BFc0050J01 mRNA, complete cds.
GenBankEU9703001e-118EU970300.1 Zea mays clone 343188 sucrose responsive element binding protein mRNA, complete cds.
GenBankHQ8587061e-118HQ858706.1 Zea mays clone UT1162 MYB-RELATED transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575562.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW13e-85MYB44_ARATH; Transcription factor MYB44
TrEMBLI1IIQ50.0I1IIQ5_BRADI; Uncharacterized protein
STRINGBRADI4G08220.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.11e-68myb domain protein 70